* Miniverse Apple Pie (updated 2024-12-11) ~ youtor.org

Miniverse Apple Pie (updated 2024-12-11)

Apple Pie Protein Parfait [upl. by Holden]

Apple Pie Protein Parfait

Duration: 0:58
355.2K views | 2 months ago

I think she likes apple pie 🤣 [upl. by Naeruat906]

I think she likes apple pie 🤣

Duration: 0:18
4.1M views | 3 months ago

미니벌스 오레오 파이 Miniverse Oreo Pie miniverse asmr [upl. by Efar659]

미니벌스 오레오 파이 Miniverse Oreo Pie miniverse asmr

Duration: 0:55
24.3K views | 5 months ago

Miniature Handmade Apple Studs🍎 [upl. by Llenra]

Miniature Handmade Apple Studs🍎

Duration: 0:12
12.6K views | 1 month ago

The easiest amp most delicious apple pie recipe🥧🍏 shorts [upl. by Monty]

The easiest amp most delicious apple pie recipe🥧🍏 shorts

Duration: 0:49
2.5K views | 1 month ago

فطائر التفاح السريعة 🍎 Quick Apple Pie apple explore shorts [upl. by Pierrepont]

فطائر التفاح السريعة 🍎 Quick Apple Pie apple explore shorts

Duration: 0:59
11.4K views | 3 months ago

I made TINY Miniverse Halloween Bear Pops 🐻🎃🐻 shorts miniverse halloween miniverseremix [upl. by Pavkovic338]

I made TINY Miniverse Halloween Bear Pops 🐻🎃🐻 shorts miniverse halloween miniverseremix

Duration: 0:31
800 views | 4 months ago

NEW Miniverse x Hershey Multipack Strawberry Pie 🍓 miniverse miniatures minifood shorts [upl. by Ivo]

NEW Miniverse x Hershey Multipack Strawberry Pie 🍓 miniverse miniatures minifood shorts

Duration: 0:42
203 views | 9 months ago

Miniverse Make It Mini Food Cherry Pie [upl. by Wesla]

Miniverse Make It Mini Food Cherry Pie

Duration: 2:28
2.4K views | 1 month ago

No Apple Apple pie MaChoyRap recipe foodies homecooked [upl. by Lerraf]

No Apple Apple pie MaChoyRap recipe foodies homecooked

Duration: 1:00
14.7K views | 2 months ago

Miniverse Beetlejuice Sandworm 💚🖤shorts miniverse beetlejuice halloween miniversemakeitmini [upl. by Ronoh664]

Miniverse Beetlejuice Sandworm 💚🖤shorts miniverse beetlejuice halloween miniversemakeitmini

Duration: 0:29
3.3K views | 1 month ago

Rustic apple pie…applepie pie fallbaking baking [upl. by Sirovat]

Rustic apple pie…applepie pie fallbaking baking

Duration: 0:45
3.1K views | 3 weeks ago

Apple pieshortskitchen [upl. by Naicad]

Apple pieshortskitchen

Duration: 1:01
12.4K views | 3 months ago

I made the cutest Beetlejuice Miniverse cake shorts miniverse miniversemakeitminifood tiny [upl. by Herminia]

I made the cutest Beetlejuice Miniverse cake shorts miniverse miniversemakeitminifood tiny

Duration: 0:34
2.3K views | 1 month ago

just in time for apple pie season 🥧 full recipe is on Instagram morgantpete ninjacreami [upl. by Yziar511]

just in time for apple pie season 🥧 full recipe is on Instagram morgantpete ninjacreami

Duration: 0:41
257 views | 1 month ago

IM OBSESSED with MINIVERSE SERIES Cherry Pie Hello Kitty [upl. by Aeriell800]

IM OBSESSED with MINIVERSE SERIES Cherry Pie Hello Kitty

Duration: 4:45
2.3M views | 3 weeks ago

apple pie shorts feedshorts applepie fruit applerecipe dessert baking [upl. by Yreffej]

apple pie shorts feedshorts applepie fruit applerecipe dessert baking

Duration: 0:54
76 views | 4 months ago

KEY LIME PIE miniverseminiverseminicutekeylimepiepielimeasmrsatisfyingshorts [upl. by Eldred]

KEY LIME PIE miniverseminiverseminicutekeylimepiepielimeasmrsatisfyingshorts

Duration: 0:47
399.9K views | 5 months ago

A Slice Of The Mini Brands Create Apple Pie minibrands applepie masterchef [upl. by Dorwin]

A Slice Of The Mini Brands Create Apple Pie minibrands applepie masterchef

Duration: 0:53
262 views | 1 week ago

Apple pie animation shorts [upl. by Eerual]

Apple pie animation shorts

Duration: 0:08
231.2K views | 2 months ago

빨간 사과줄까 파란 사과줄까 Apple Pie [upl. by Kcirdled]

빨간 사과줄까 파란 사과줄까 Apple Pie

Duration: 0:22
9K views | 1 month ago

making a mini pumpkin pie 🎃 miniverse halloween [upl. by Ilyah]

making a mini pumpkin pie 🎃 miniverse halloween

Duration: 0:21
506 views | 3 Nov 2023

Miniverse Cookies and Creme Pie Oreo Dessert [upl. by Palma853]

Miniverse Cookies and Creme Pie Oreo Dessert

Duration: 7:19
2.5K views | 6 Jul 2014

Miniverse Trailer [upl. by Rahr382]

Miniverse Trailer

Duration: 1:43
3.6K views | 2 weeks ago

Apple pie blush 🍎✨ [upl. by Cruickshank]

Apple pie blush 🍎✨

Duration: 0:06
1K views | 2 months ago

Miniverse X Hello Kitty Apple Pie subscribe miniverse hellokitty [upl. by Nelon]

Miniverse X Hello Kitty Apple Pie subscribe miniverse hellokitty

Duration: 0:44
11.9K views | 2 months ago

making mini halloween jello 🪱 miniverse miniverseremix halloween [upl. by Nylaehs238]

making mini halloween jello 🪱 miniverse miniverseremix halloween

Duration: 0:43
836 views | 4 months ago

making mini bug punch halloween miniverse [upl. by Fenelia]

making mini bug punch halloween miniverse

Duration: 8:00
1.3M views | 2 weeks ago

Homer makes a pie with his mom🥰🥮 shorts [upl. by Christiansen]

Homer makes a pie with his mom🥰🥮 shorts

Duration: 0:47
100 views | 24 Oct 2023

Halloween Miniverse Make it Mini capsules Pumpkin Pie amp Caramel Apple fall doll accessories [upl. by Kara141]

Halloween Miniverse Make it Mini capsules Pumpkin Pie amp Caramel Apple fall doll accessories

Duration: 9:50
|

Our site allows you to download your favorite videos in MP3 (audio) or MP4 (video) format in the most efficient way. You can find your favorite videos using "search" to download them.

New on site

Content Report
youtor.org / Youtor Videos converter © 2024